PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YC
Protein Properties Length: 253aa    MW: 28555.7 Da    PI: 5.4796
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26401.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.21.8e-187861998
       NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                +++P +rikki+++dedv +i+  +P l+ska elf+ +l   ++  + +   +t++   ++++v   ++fdfl d+v +
  KFK26401.1  7 TRFPATRIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCNHTYDVTVSRGAKTVNSVHLKQCVHAFNVFDFLKDTVAK 86
                689**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-24272IPR009072Histone-fold
SuperFamilySSF471136.92E-19389IPR009072Histone-fold
PfamPF008085.1E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MKKKLSTRFP ATRIKKIMQT DEDVGKIAMA VPLLVSKALE LFLQDLCNHT YDVTVSRGAK  60
TVNSVHLKQC VHAFNVFDFL KDTVAKVPDL GGSEGEEQSA TKRRKLVDES SCNDEYMMKA  120
TQMHEVKHTG VSRGRRGRGR GRGSGRTRSS VQSLKFEDDV EDGSPESSRS PSFENDVKTE  180
CFEEQNNHRT NSKVIRNFDL NVGLEGLDEN EDYKEGSRAW PFLGMNEMKT DPYQQGSSIG  240
NEEDYDEESL DEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A7e-24271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132142RGRRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197450.21e-100Histone superfamily protein
TrEMBLA0A087G9490.0A0A087G949_ARAAL; Uncharacterized protein
STRINGAT5G19490.11e-99(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139682124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.11e-100NF-YC family protein